Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SMAP1 Peptide - N-terminal region

SMAP1 Peptide - N-terminal region

Product Specifications

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SMAP1 Rabbit Polyclonal Antibody (orb326090) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

XP_002727223

Preservative

Lyophilized powder

AA Sequence

MATRSCREKAQKLNEQHQLILSKLLREEDNKYCADCEAKGPRWASWNIGV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Snurportin 1 (SNUPN) ELISA kit
GTR10375698 96 Well

Mouse Snurportin 1 (SNUPN) ELISA kit

Sign In for Pricing
View Details
Wishful Thinking (WIT) Antibody BIOTIN-Conjugated
MBS5400242-01 0.1 mg

Wishful Thinking (WIT) Antibody BIOTIN-Conjugated

Sign In for Pricing
View Details
Wishful Thinking (WIT) Antibody BIOTIN-Conjugated
MBS5400242-02 5x 0.1 mg

Wishful Thinking (WIT) Antibody BIOTIN-Conjugated

Sign In for Pricing
View Details
Paqr5 Mouse siRNA Oligo Duplex (Locus ID 74090)
SR410241 1 Kit

Paqr5 Mouse siRNA Oligo Duplex (Locus ID 74090)

Sign In for Pricing
View Details
GNL1 Rabbit pAb, IRDye 800CW conjugated
orb2882457 100 µL

GNL1 Rabbit pAb, IRDye 800CW conjugated

Sign In for Pricing
View Details
PITX-1 Rabbit Polyclonal Antibody (Cy3)
orb979178 100 µL

PITX-1 Rabbit Polyclonal Antibody (Cy3)

Sign In for Pricing
View Details