Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LPGAT1 Peptide - C-terminal region

LPGAT1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

FAM34A, FAM34A1, NET8

UniProt

Q92604

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with LPGAT1 Rabbit Polyclonal Antibody (orb585344) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_055688

Preservative

Lyophilized powder

AA Sequence

KNGSPAGGDAKELDSKSKGLQWIIDTTIAYPKAEPIDIQTWILGYRKPTV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Magic™ Membrane Protein Human B3GNT7 (UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 7) Expressed in E.coli with 10xHis tag at the N-terminus, Myc tag at the C-terminus for Antibody Discovery, PaRoom Temperatureial (27-401aa)
MPX4118K Each

Magic™ Membrane Protein Human B3GNT7 (UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 7) Expressed in E.coli with 10xHis tag at the N-terminus, Myc tag at the C-terminus for Antibody Discovery, PaRoom Temperatureial (27-401aa)

Sign In for Pricing
View Details
Tarcocimab Biosimilar (Monoclonal, IgG1-kappa)
A135550 100 µL

Tarcocimab Biosimilar (Monoclonal, IgG1-kappa)

Sign In for Pricing
View Details
Affinity Purified anti-Mouse IgG h+l Antibody (cross-adsorbed)
MBS5317422-01 1 mg

Affinity Purified anti-Mouse IgG h+l Antibody (cross-adsorbed)

Sign In for Pricing
View Details
Affinity Purified anti-Mouse IgG h+l Antibody (cross-adsorbed)
MBS5317422-02 5x 1 mg

Affinity Purified anti-Mouse IgG h+l Antibody (cross-adsorbed)

Sign In for Pricing
View Details
TLR9, CT (Toll-like Receptor 9, CD289, UNQ5798/PRO19605) (APC) discontinued
T8050-95C-APC 200 µL

TLR9, CT (Toll-like Receptor 9, CD289, UNQ5798/PRO19605) (APC) discontinued

Sign In for Pricing
View Details
BCL2L13 Antibody
MBS2521651-01 0.06 mL

BCL2L13 Antibody

Sign In for Pricing
View Details