Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LPGAT1 Peptide - C-terminal region

LPGAT1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

FAM34A, FAM34A1, NET8

UniProt

Q92604

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with LPGAT1 Rabbit Polyclonal Antibody (orb585344) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_055688

Preservative

Lyophilized powder

AA Sequence

KNGSPAGGDAKELDSKSKGLQWIIDTTIAYPKAEPIDIQTWILGYRKPTV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZFP57 Antibody (Center)
MBS9204785-01 0.08 mL

ZFP57 Antibody (Center)

Sign In for Pricing
View Details
ZFP57 Antibody (Center)
MBS9204785-02 0.4 mL

ZFP57 Antibody (Center)

Sign In for Pricing
View Details
ZFP57 Antibody (Center)
MBS9204785-03 5x 0.4 mL

ZFP57 Antibody (Center)

Sign In for Pricing
View Details
Biotin-Linked Polyclonal Antibody to Keratin 18 (KRT18)
MBS2093026-01 0.1 mL

Biotin-Linked Polyclonal Antibody to Keratin 18 (KRT18)

Sign In for Pricing
View Details
Biotin-Linked Polyclonal Antibody to Keratin 18 (KRT18)
MBS2093026-02 0.2 mL

Biotin-Linked Polyclonal Antibody to Keratin 18 (KRT18)

Sign In for Pricing
View Details
Biotin-Linked Polyclonal Antibody to Keratin 18 (KRT18)
MBS2093026-03 0.5 mL

Biotin-Linked Polyclonal Antibody to Keratin 18 (KRT18)

Sign In for Pricing
View Details