Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LRRC39 Peptide - C-terminal region

LRRC39 Peptide - C-terminal region

Product Specifications

Product Name Alternative

DKFZp313O1122, MGC14816

UniProt

Q96DD0

Field of Research

Neuroscience; Musculoskeletal & Connective Tissue Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with LRRC39 Rabbit Polyclonal Antibody (orb585442) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_653221

Preservative

Lyophilized powder

AA Sequence

FRDNPLKLKVSLPPSEGTDEEEERELFGLQFMHTYIQESRRRADHQVNGS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Donkey Urocortin 2 ELISA Kit
MBS107244 Inquire

Donkey Urocortin 2 ELISA Kit

Sign In for Pricing
View Details
RGD1308147 sgRNA CRISPR Lentivector (Rat) (Target 1)
K7330402 1.0 µg DNA

RGD1308147 sgRNA CRISPR Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
Inhibin beta A Rabbit Monoclonal Antibody
AMRe02157-01 1 Each

Inhibin beta A Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Inhibin beta A Rabbit Monoclonal Antibody
AMRe02157-02 50 µL

Inhibin beta A Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Inhibin beta A Rabbit Monoclonal Antibody
AMRe02157-03 100 µL

Inhibin beta A Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Anti-RAB4 Antibody (9W15)
TMAB-11999-01 25 µL

Anti-RAB4 Antibody (9W15)

Sign In for Pricing
View Details