Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LRRC39 Peptide - C-terminal region

LRRC39 Peptide - C-terminal region

Product Specifications

Product Name Alternative

DKFZp313O1122, MGC14816

UniProt

Q96DD0

Field of Research

Neuroscience; Musculoskeletal & Connective Tissue Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with LRRC39 Rabbit Polyclonal Antibody (orb585442) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_653221

Preservative

Lyophilized powder

AA Sequence

FRDNPLKLKVSLPPSEGTDEEEERELFGLQFMHTYIQESRRRADHQVNGS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Benzophenone 99% Extrapure
00384 00500 500 g

Benzophenone 99% Extrapure

Sign In for Pricing
View Details
Recombinant Human HSF2 Protein, His Tag
E40KMH1226 20 µg

Recombinant Human HSF2 Protein, His Tag

Sign In for Pricing
View Details
Mouse Monoclonal CD8 Antibody (C8/144B) [FITC]
NBP2-34588F 0.1 mL

Mouse Monoclonal CD8 Antibody (C8/144B) [FITC]

Sign In for Pricing
View Details
5-Bromo-3-methoxypicolinic acid
SVB19166 5 g

5-Bromo-3-methoxypicolinic acid

Sign In for Pricing
View Details
Cornulin shRNA (h) Lentiviral Particles
sc-88337-V 200 µL

Cornulin shRNA (h) Lentiviral Particles

Sign In for Pricing
View Details
GINS4 siRNA (Rat)
CRR4121-01 15 nmol

GINS4 siRNA (Rat)

Sign In for Pricing
View Details