Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Lyn Peptide - N-terminal region

Lyn Peptide - N-terminal region

Product Specifications

Product Name Alternative

AA407514, Hck-2, p53Lyn, p56Lyn

UniProt

Q8CEI0

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Lyn Rabbit Polyclonal Antibody (orb330773) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_034877

Preservative

Lyophilized powder

AA Sequence

QGDIVVALYPYDGIHPDDLSFKKGEKMKVLEEHGEWWKAKSLSSKREGFI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-ROCK2 (Ser1379) Antibody
AF7142-01 100 µL

Phospho-ROCK2 (Ser1379) Antibody

Sign In for Pricing
View Details
Phospho-ROCK2 (Ser1379) Antibody
AF7142-02 200 µL

Phospho-ROCK2 (Ser1379) Antibody

Sign In for Pricing
View Details
Magic™ Membrane Protein Human C1orf162 (Chromosome 1 open reading frame 162) Expressed in vitro E.coli expression system, Full Length
MPX1199K Each

Magic™ Membrane Protein Human C1orf162 (Chromosome 1 open reading frame 162) Expressed in vitro E.coli expression system, Full Length

Sign In for Pricing
View Details
Mouse Procollagen I C-Terminal Propeptide (PICP) ELISA Kit
RDR-PICP-Mu-01 96 Tests

Mouse Procollagen I C-Terminal Propeptide (PICP) ELISA Kit

Sign In for Pricing
View Details
Mouse Procollagen I C-Terminal Propeptide (PICP) ELISA Kit
RDR-PICP-Mu-02 48 Tests

Mouse Procollagen I C-Terminal Propeptide (PICP) ELISA Kit

Sign In for Pricing
View Details
GW274150
T11518L-01 1 mg

GW274150

Sign In for Pricing
View Details