Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Lyn Peptide - N-terminal region

Lyn Peptide - N-terminal region

Product Specifications

Product Name Alternative

AA407514, Hck-2, p53Lyn, p56Lyn

UniProt

Q8CEI0

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Lyn Rabbit Polyclonal Antibody (orb330773) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_034877

Preservative

Lyophilized powder

AA Sequence

QGDIVVALYPYDGIHPDDLSFKKGEKMKVLEEHGEWWKAKSLSSKREGFI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse Mitochondrial 2-oxodicarboxylate carrier (Slc25a21)
MBS7029885-01 0.02 mg

Recombinant Mouse Mitochondrial 2-oxodicarboxylate carrier (Slc25a21)

Sign In for Pricing
View Details
Recombinant Mouse Mitochondrial 2-oxodicarboxylate carrier (Slc25a21)
MBS7029885-02 0.1 mg

Recombinant Mouse Mitochondrial 2-oxodicarboxylate carrier (Slc25a21)

Sign In for Pricing
View Details
Recombinant Mouse Mitochondrial 2-oxodicarboxylate carrier (Slc25a21)
MBS7029885-03 5x 0.1 mg

Recombinant Mouse Mitochondrial 2-oxodicarboxylate carrier (Slc25a21)

Sign In for Pricing
View Details
4-[ (Carbamoylmethyl) sulfamoyl]-1H-pyrrole-2-carboxylic acid
SRB62369-01 50 mg

4-[ (Carbamoylmethyl) sulfamoyl]-1H-pyrrole-2-carboxylic acid

Sign In for Pricing
View Details
4-[ (Carbamoylmethyl) sulfamoyl]-1H-pyrrole-2-carboxylic acid
SRB62369-02 0.5 g

4-[ (Carbamoylmethyl) sulfamoyl]-1H-pyrrole-2-carboxylic acid

Sign In for Pricing
View Details
OneScript Hot Reverse Transcriptase
TBS4056 100 Reactions

OneScript Hot Reverse Transcriptase

Sign In for Pricing
View Details