Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MAGEL2 Peptide - C-terminal region

MAGEL2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

NDNL1, nM15

UniProt

Q9UJ55

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MAGEL2 Rabbit Polyclonal Antibody (orb584499) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

Q9UJ55.1

Preservative

Lyophilized powder

AA Sequence

MTPSGECRASSIDRRGSSKERRTSSKERRAPSKDRMIFAATFCAPKAVSA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Brk (PTK6) (N-term) Rabbit Polyclonal Antibody
AP14474PU-N 400 µL

Brk (PTK6) (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human SUHW2 (ZNF280B) activation kit by CRISPRa
GA115427 1 Kit

Human SUHW2 (ZNF280B) activation kit by CRISPRa

Sign In for Pricing
View Details
3-Acenaphthenamine
TRC-A130730-25MG 25 mg

3-Acenaphthenamine

Sign In for Pricing
View Details
Tide Quencher™ 7.1WS maleimide [TQ7.1WS maleimide]
2118-AAT 1 mg

Tide Quencher™ 7.1WS maleimide [TQ7.1WS maleimide]

Sign In for Pricing
View Details
PODXL Antibody
OC-859-01 50 μL

PODXL Antibody

Sign In for Pricing
View Details
PODXL Antibody
OC-859-02 100 µL

PODXL Antibody

Sign In for Pricing
View Details