MAP3K15 Peptide - C-terminal region
MAP3K15 Peptide - C-terminal region
Product Specifications
Product Name Alternative
FLJ16518, bA723P2.3
UniProt
Q6ZN16
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_001001671
Preservative
Lyophilized powder
AA Sequence
YQNLLRQTLEQKTQELYHLQLKLKSNCITENPAGPYGQRTDKELIDWLRL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
GTR15320239 1 Vial
Lentiviral human LRRC55 shRNA (UAS) - Lentiviral human LRRC55 shRNA (UAS, iRFP) plasmid
Sign In for Pricing
View Details 
S7972-46-ML750 100 µL
STAT 6, phosphorylated (STAT6B, STAT6C, D12S1644, IL-4-STAT, interleukin 4 induced STAT, Signal Transducer and Activator of Transcription 6) (MaxLight 750) discontinued
Sign In for Pricing
View Details orb2935313-01 20 µg
Recombinant Distoechurus pennatus NADH-ubiquinone oxidoreductase chain 4L (MT-ND4L)
Sign In for Pricing
View Details orb2935313-02 100 µg
Recombinant Distoechurus pennatus NADH-ubiquinone oxidoreductase chain 4L (MT-ND4L)
Sign In for Pricing
View Details