What is the catalog number for MAP3K15 Peptide - C-terminal region?

The catalog number for MAP3K15 Peptide - C-terminal region is orb2010012.

What sizes are available for MAP3K15 Peptide - C-terminal region?

MAP3K15 Peptide - C-terminal region is available in the following size(s): 100 µg.

Is MAP3K15 Peptide - C-terminal region in stock?

MAP3K15 Peptide - C-terminal region is currently made to order / not held in immediate stock. Contact us for lead time.

MAP3K15 Peptide - C-terminal region

Product Specifications

Product Name Alternative

FLJ16518, bA723P2.3

UniProt

Q6ZN16

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001001671

Preservative

Lyophilized powder

AA Sequence

YQNLLRQTLEQKTQELYHLQLKLKSNCITENPAGPYGQRTDKELIDWLRL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

039364-ML750 100 µL

OR2M7, CT (OR2M7, Olfactory receptor 2M7, Olfactory receptor OR1-58) (MaxLight 750) discontinued

Sign In for Pricing

View Details

NB100-2768H 0.1 mL

Mouse Monoclonal Papillomavirus 16 E7 Antibody (TVG 701Y) [HRP]

Sign In for Pricing

View Details

50550151 3x 1.0 µg DNA

XPA CRISPR All-in-one AAV vector set (with saCas9)(Human)

Sign In for Pricing

View Details

A03891-2-Fluoro594 100 µg/Vial

Anti-PTF1A Antibody Picoband® Fluoro594 Conjugated

Sign In for Pricing

View Details

BS49500-01 50 µL

CENPE Recombinant Rabbit mAb

Sign In for Pricing

View Details

BS49500-02 100 µL

CENPE Recombinant Rabbit mAb

Sign In for Pricing

View Details