Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MBD1 Peptide - C-terminal region

MBD1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CXXC3, PCM1, RFT

UniProt

Q9UIS9

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MBD1 Rabbit Polyclonal Antibody (orb574340) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001191067

Preservative

Lyophilized powder

AA Sequence

EEDKEENKDDSASKLAPEEEAGGAGTPVITEIFSLGGTRFRDTAVWLPRS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Eph receptor B3 Polyclonal Antibody
E-AB-90108-01 60 µL

Eph receptor B3 Polyclonal Antibody

Sign In for Pricing
View Details
Eph receptor B3 Polyclonal Antibody
E-AB-90108-02 120 µL

Eph receptor B3 Polyclonal Antibody

Sign In for Pricing
View Details
Eph receptor B3 Polyclonal Antibody
E-AB-90108-03 200 µL

Eph receptor B3 Polyclonal Antibody

Sign In for Pricing
View Details
DOG-1 / TMEM16A (Gastrointestinal Stromal Tumor Marker) (DG1/1486), 0.2mg/mL
BNUB1486-500 1x 500 µL

DOG-1 / TMEM16A (Gastrointestinal Stromal Tumor Marker) (DG1/1486), 0.2mg/mL

Sign In for Pricing
View Details
RAB5A Polyclonal Antibody
E-AB-40241-01 25 µL

RAB5A Polyclonal Antibody

Sign In for Pricing
View Details
RAB5A Polyclonal Antibody
E-AB-40241-02 100 µL

RAB5A Polyclonal Antibody

Sign In for Pricing
View Details