Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EEF1AKMT2 Peptide - middle region

EEF1AKMT2 Peptide - middle region

Product Specifications

Product Name Alternative

Mettl10, 2010208K18Rik

UniProt

Q9D853

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with EEF1AKMT2 Rabbit Polyclonal Antibody (orb580677) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_082371

Preservative

Lyophilized powder

AA Sequence

VDKGTYDAISLNPDNAIEKRKQYVMSLSRVLEVKGFFLITSCNWTKAELL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

APC/CY7-Linked Polyclonal Antibody to Laminin Gamma 1 (LAMC1)
MBS2062909-01 0.1 mL

APC/CY7-Linked Polyclonal Antibody to Laminin Gamma 1 (LAMC1)

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to Laminin Gamma 1 (LAMC1)
MBS2062909-02 0.2 mL

APC/CY7-Linked Polyclonal Antibody to Laminin Gamma 1 (LAMC1)

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to Laminin Gamma 1 (LAMC1)
MBS2062909-03 0.5 mL

APC/CY7-Linked Polyclonal Antibody to Laminin Gamma 1 (LAMC1)

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to Laminin Gamma 1 (LAMC1)
MBS2062909-04 1 mL

APC/CY7-Linked Polyclonal Antibody to Laminin Gamma 1 (LAMC1)

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to Laminin Gamma 1 (LAMC1)
MBS2062909-05 5 mL

APC/CY7-Linked Polyclonal Antibody to Laminin Gamma 1 (LAMC1)

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to Laminin Gamma 1 (LAMC1)
MBS2062909-06 5x 5 mL

APC/CY7-Linked Polyclonal Antibody to Laminin Gamma 1 (LAMC1)

Sign In for Pricing
View Details