Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EEF1AKMT2 Peptide - middle region

EEF1AKMT2 Peptide - middle region

Product Specifications

Product Name Alternative

Mettl10, 2010208K18Rik

UniProt

Q9D853

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with EEF1AKMT2 Rabbit Polyclonal Antibody (orb580677) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_082371

Preservative

Lyophilized powder

AA Sequence

VDKGTYDAISLNPDNAIEKRKQYVMSLSRVLEVKGFFLITSCNWTKAELL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MARCH I (MARCH1) Human Over-expression Lysate
orb1359574 20 µg

MARCH I (MARCH1) Human Over-expression Lysate

Sign In for Pricing
View Details
Phospho-IRF3 (Ser396) Rabbit Polyclonal Antibody (PE-Cy5.5)
orb904176 100 µL

Phospho-IRF3 (Ser396) Rabbit Polyclonal Antibody (PE-Cy5.5)

Sign In for Pricing
View Details
Lentiviral human C19orf73 shRNA (UAS) - Lentiviral human C19orf73 shRNA (UAS, RFP) plasmid
GTR15095281 1 Vial

Lentiviral human C19orf73 shRNA (UAS) - Lentiviral human C19orf73 shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
(1-Cyclohexylazetidin-2-yl) methanol
GBA24732-01 50 mg

(1-Cyclohexylazetidin-2-yl) methanol

Sign In for Pricing
View Details
(1-Cyclohexylazetidin-2-yl) methanol
GBA24732-02 0.5 g

(1-Cyclohexylazetidin-2-yl) methanol

Sign In for Pricing
View Details
ZNF575 Blocking Peptide
CBP5656-01 1 mg

ZNF575 Blocking Peptide

Sign In for Pricing
View Details