Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MIF Peptide - middle region

MIF Peptide - middle region

Product Specifications

Product Name Alternative

GIF, GLIF, MMIF

UniProt

P14174

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MIF Rabbit Polyclonal Antibody (orb583119) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_002406

Preservative

Lyophilized powder

AA Sequence

PQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Myostatin, NT (Growth/Differentiation Factor 8, GDF-, MSTN, GDF8) (Azide free) (HRP) discontinued
M9875-01A-HRP 200 µL

Myostatin, NT (Growth/Differentiation Factor 8, GDF-, MSTN, GDF8) (Azide free) (HRP) discontinued

Sign In for Pricing
View Details
Streptococcus pneumoniae qPCR kit (Lyophilized)
YZB1301L 96 Tests

Streptococcus pneumoniae qPCR kit (Lyophilized)

Sign In for Pricing
View Details
Human BCL2L13 Pre-designed siRNA Set B
SI001491B 1 Each

Human BCL2L13 Pre-designed siRNA Set B

Sign In for Pricing
View Details
FBLN1 (Fibulin 1, FBLN, Fibulin-1, FIBL-1, PP213) (AP)
MBS6378185-01 0.1 mL

FBLN1 (Fibulin 1, FBLN, Fibulin-1, FIBL-1, PP213) (AP)

Sign In for Pricing
View Details
FBLN1 (Fibulin 1, FBLN, Fibulin-1, FIBL-1, PP213) (AP)
MBS6378185-02 5x 0.1 mL

FBLN1 (Fibulin 1, FBLN, Fibulin-1, FIBL-1, PP213) (AP)

Sign In for Pricing
View Details
Phospho-MERTK/TYRO3 (Y749/681) Antibody
CSB-PA006532-01 50 µg

Phospho-MERTK/TYRO3 (Y749/681) Antibody

Sign In for Pricing
View Details