MMP3 Peptide - middle region
MMP3 Peptide - middle region
Product Specifications
Product Name Alternative
CHDS6, MGC126102, MGC126103, MGC126104, MMP-3, SL-1, STMY, STMY1, STR1
UniProt
P28862
Field of Research
Immunology & Inflammation
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with MMP3 Rabbit Polyclonal Antibody (orb578317) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
IHC, WB
NCBI Accession Number
NP_002413
Preservative
Lyophilized powder
AA Sequence
SFAVREHGDFYPFDGPGNVLAHAYAPGPGINGDAHFDDDEQWTKDTTGTN
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC400698-500 1x 500 µL
Chromogranin A (LK2H10 + PHE5), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
LC400639 20 µg
bcl 6 (BCL6) (NM_001706) Human Over-expression Lysate
Sign In for Pricing
View Details 
BNC470668-100 1x 100 µL
MART-1 / Melan-A (A103), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC740158-500 1x 500 µL
Cytokeratin 17 (E3), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details