Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MMP3 Peptide - middle region

MMP3 Peptide - middle region

Product Specifications

Product Name Alternative

CHDS6, MGC126102, MGC126103, MGC126104, MMP-3, SL-1, STMY, STMY1, STR1

UniProt

P28862

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MMP3 Rabbit Polyclonal Antibody (orb578317) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

IHC, WB

NCBI Accession Number

NP_002413

Preservative

Lyophilized powder

AA Sequence

SFAVREHGDFYPFDGPGNVLAHAYAPGPGINGDAHFDDDEQWTKDTTGTN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NPY2R (N-term) Rabbit Polyclonal Antibody
AP52925PU-N 400 µL

NPY2R (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
HNRNPC Rabbit Polyclonal Antibody
AP20405PU-N 100 µg

HNRNPC Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
WT1 (Wilm's Tumor 1) (WT1/857), CF405S conjugate, 0.1mg/mL
BNC040857-100 1x 100 µL

WT1 (Wilm's Tumor 1) (WT1/857), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
IFNG Rabbit Polyclonal Antibody
TA397113 100 µg

IFNG Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
4-Aminoimidazole Dihydrochloride
TRC-A611815-50MG 50 mg

4-Aminoimidazole Dihydrochloride

Sign In for Pricing
View Details
Glutathione Peroxidase 4 Antibody (Biotin)
KB-21259-01 50 μL

Glutathione Peroxidase 4 Antibody (Biotin)

Sign In for Pricing
View Details