Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Morn4 Peptide - C-terminal region

Morn4 Peptide - C-terminal region

Product Specifications

Product Name Alternative

2810038N09Rik

UniProt

Q9CZ83

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Morn4 Rabbit Polyclonal Antibody (orb582053) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_080311

Preservative

Lyophilized powder

AA Sequence

GFGLLTFPDGSHGIPRNEGLFENNKLLRREKCSAVVQRAQSASKSARNLT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GPR133 Polyclonal Antibody
BT-AP03691-01 20 µL

GPR133 Polyclonal Antibody

Sign In for Pricing
View Details
GPR133 Polyclonal Antibody
BT-AP03691-02 50 µL

GPR133 Polyclonal Antibody

Sign In for Pricing
View Details
GPR133 Polyclonal Antibody
BT-AP03691-03 100 µL

GPR133 Polyclonal Antibody

Sign In for Pricing
View Details
ICOSLG Protein (C-human IgG1-Fc, Rat)
P525432 100 µg

ICOSLG Protein (C-human IgG1-Fc, Rat)

Sign In for Pricing
View Details
DHX30 Rabbit pAb
E47R14313 100 µL

DHX30 Rabbit pAb

Sign In for Pricing
View Details
Mouse Monoclonal Dihydrofolate Reductase/DHFR Antibody (OTI6G7) [Dylight 594]
NBP2-70569DL594 0.1 mL

Mouse Monoclonal Dihydrofolate Reductase/DHFR Antibody (OTI6G7) [Dylight 594]

Sign In for Pricing
View Details