Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Morn4 Peptide - C-terminal region

Morn4 Peptide - C-terminal region

Product Specifications

Product Name Alternative

2810038N09Rik

UniProt

Q9CZ83

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Morn4 Rabbit Polyclonal Antibody (orb582053) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_080311

Preservative

Lyophilized powder

AA Sequence

GFGLLTFPDGSHGIPRNEGLFENNKLLRREKCSAVVQRAQSASKSARNLT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Prostate Specific Antigen (PSA) (Free), Antibody
GWB-E50FB0 1 mg

Prostate Specific Antigen (PSA) (Free), Antibody

Sign In for Pricing
View Details
Ppp6r2 3'UTR Luciferase Stable Cell Line
TU116860 1.0 mL

Ppp6r2 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Anti-PBEF1
ARP42255_T100 100 µL

Anti-PBEF1

Sign In for Pricing
View Details
Goat Annexin III (ANX- III) ELISA Kit
MBS7251289-01 48 Well

Goat Annexin III (ANX- III) ELISA Kit

Sign In for Pricing
View Details
Goat Annexin III (ANX- III) ELISA Kit
MBS7251289-02 96 Well

Goat Annexin III (ANX- III) ELISA Kit

Sign In for Pricing
View Details
Goat Annexin III (ANX- III) ELISA Kit
MBS7251289-03 5x 96 Well

Goat Annexin III (ANX- III) ELISA Kit

Sign In for Pricing
View Details