NAPRT Peptide - C-terminal region
NAPRT Peptide - C-terminal region
Product Specifications
Product Name Alternative
NAPRT1, PP3856
UniProt
Q6XQN6
Field of Research
Cancer Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with NAPRT Rabbit Polyclonal Antibody (orb585453) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_660202
Preservative
Lyophilized powder
AA Sequence
GGQPRMKLTEDPEKQTLPGSKAAFRLLGSDGSPLMDMLQLAEEPVPQAGQ
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC402267-500 1x 500 µL
Cell Division Cycle 34 homolog (CPTC-CDC34-2), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
RDR-VEGFR1-Ra-01 96 Tests
Rat Vascular Endothelial Growth Factor Receptor 1 (VEGFR1) ELISA Kit
Sign In for Pricing
View Details RDR-VEGFR1-Ra-02 48 Tests
Rat Vascular Endothelial Growth Factor Receptor 1 (VEGFR1) ELISA Kit
Sign In for Pricing
View Details 
BNC042759-500 1x 500 µL
BARX1 (Prognostic Biomarker in Hepatocellular Carcinoma) (BARX1/2759), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details