Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NAPRT Peptide - C-terminal region

NAPRT Peptide - C-terminal region

Product Specifications

Product Name Alternative

NAPRT1, PP3856

UniProt

Q6XQN6

Field of Research

Cancer Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NAPRT Rabbit Polyclonal Antibody (orb585453) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_660202

Preservative

Lyophilized powder

AA Sequence

GGQPRMKLTEDPEKQTLPGSKAAFRLLGSDGSPLMDMLQLAEEPVPQAGQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLC35B4 Human Gene Knockout Kit (CRISPR)
KN203263RB 1 Kit

SLC35B4 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tissue FFPE Sections, Ovary: left
CS714154 5x 5 µm

Tissue FFPE Sections, Ovary: left

Sign In for Pricing
View Details
Recombinant Lactoferrin Antibody
RC-15571-01 50 μL

Recombinant Lactoferrin Antibody

Sign In for Pricing
View Details
Recombinant Lactoferrin Antibody
RC-15571-02 100 µL

Recombinant Lactoferrin Antibody

Sign In for Pricing
View Details
Recombinant Lactoferrin Antibody
RC-15571-03 1 mL

Recombinant Lactoferrin Antibody

Sign In for Pricing
View Details
1,7-Dibromoheptane
TRC-D425580-50G 50 g

1,7-Dibromoheptane

Sign In for Pricing
View Details