Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NDUFS1 Peptide - middle region

NDUFS1 Peptide - middle region

Product Specifications

Product Name Alternative

CI-75Kd, MGC26839, PRO1304, CI-75k

UniProt

P28331

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NDUFS1 Rabbit Polyclonal Antibody (orb330870) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_004997

Preservative

Lyophilized powder

AA Sequence

TPPGLAREDWKIIRALSEIAGMTLPYDTLDQVRNRLEEVSPNLVRYDDIE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human PRR20B activation kit by CRISPRa
GA118991 1 Kit

Human PRR20B activation kit by CRISPRa

Sign In for Pricing
View Details
NECAP2 (NM_001145278) Human Over-expression Lysate
LC428782 20 µg

NECAP2 (NM_001145278) Human Over-expression Lysate

Sign In for Pricing
View Details
FGD5 Polyclonal Antibody
E-AB-66464-01 60 µL

FGD5 Polyclonal Antibody

Sign In for Pricing
View Details
FGD5 Polyclonal Antibody
E-AB-66464-02 120 µL

FGD5 Polyclonal Antibody

Sign In for Pricing
View Details
FGD5 Polyclonal Antibody
E-AB-66464-03 200 µL

FGD5 Polyclonal Antibody

Sign In for Pricing
View Details
FABP3 Polyclonal Antibody
E-AB-40515-01 25 µL

FABP3 Polyclonal Antibody

Sign In for Pricing
View Details