Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Nfia Peptide - C-terminal region

Nfia Peptide - C-terminal region

Product Specifications

Product Name Alternative

1110047K16Rik, 9430022M17Rik, NF1-A, NF1A

UniProt

E9QKP1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Nfia Rabbit Polyclonal Antibody (orb576772) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_035035

Preservative

Lyophilized powder

AA Sequence

PMPDTKPPTTSTEGGAASPTSPTYSTPSTSPANRFVSVGPRDPSFVNIPQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

STAU1 Over-expression Lysate Product
GWB-A70E21 0.1 mg

STAU1 Over-expression Lysate Product

Sign In for Pricing
View Details
UPRT Polyclonal Antibody
A61686-100 100 µL

UPRT Polyclonal Antibody

Sign In for Pricing
View Details
TRA (TCRA, TCRD, TRA, T-cell antigen receptor, alpha polypeptide, T-cell receptor, alpha (V, D, J, C) )
588786 50 µg

TRA (TCRA, TCRD, TRA, T-cell antigen receptor, alpha polypeptide, T-cell receptor, alpha (V, D, J, C) )

Sign In for Pricing
View Details
Myeloid Cell Surface Antigen CD33 (CD33) Antibody (PE)
abx134572-01 50 Assays

Myeloid Cell Surface Antigen CD33 (CD33) Antibody (PE)

Sign In for Pricing
View Details
Myeloid Cell Surface Antigen CD33 (CD33) Antibody (PE)
abx134572-02 100 Assays

Myeloid Cell Surface Antigen CD33 (CD33) Antibody (PE)

Sign In for Pricing
View Details
RSU1 Antibody
orb1278984 100 µL

RSU1 Antibody

Sign In for Pricing
View Details