Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NODAL Peptide - middle region

NODAL Peptide - middle region

Product Specifications

Product Name Alternative

MGC138230, HTX5

UniProt

Q96S42

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NODAL Rabbit Polyclonal Antibody (orb330915) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_060525

Preservative

Lyophilized powder

AA Sequence

EFHPTNHAYIQSLLKRYQPHRVPSTCCAPVKTKPLSMLYVDNGRVLLDHH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Canine Enlin (ENG) ELISA kit
GTR10372237 96 Well

Canine Enlin (ENG) ELISA kit

Sign In for Pricing
View Details
FUCA2 Polyclonal Antibody, PerCP-Cy5.5 Conjugated
bs-16192R-PerCP-Cy5.5 100 µL

FUCA2 Polyclonal Antibody, PerCP-Cy5.5 Conjugated

Sign In for Pricing
View Details
KANK2 Rabbit Polyclonal Antibody
orb628184-01 50 µg

KANK2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
KANK2 Rabbit Polyclonal Antibody
orb628184-02 100 µg

KANK2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
MB Mouse Monoclonal Antibody
AMM81348-01 1 Each

MB Mouse Monoclonal Antibody

Sign In for Pricing
View Details
MB Mouse Monoclonal Antibody
AMM81348-02 50 µL

MB Mouse Monoclonal Antibody

Sign In for Pricing
View Details