Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NODAL Peptide - middle region

NODAL Peptide - middle region

Product Specifications

Product Name Alternative

MGC138230, HTX5

UniProt

Q96S42

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NODAL Rabbit Polyclonal Antibody (orb330915) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_060525

Preservative

Lyophilized powder

AA Sequence

EFHPTNHAYIQSLLKRYQPHRVPSTCCAPVKTKPLSMLYVDNGRVLLDHH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CLDN12 Antibody (N-term)
E45R15476G-4 50 µL

CLDN12 Antibody (N-term)

Sign In for Pricing
View Details
Ricinine
TRC-R495550-1MG 1 mg

Ricinine

Sign In for Pricing
View Details
Mouse GPR52 shRNA Plasmid
abx984158-01 150 µg

Mouse GPR52 shRNA Plasmid

Sign In for Pricing
View Details
Mouse GPR52 shRNA Plasmid
abx984158-02 300 µg

Mouse GPR52 shRNA Plasmid

Sign In for Pricing
View Details
ENO4 Rabbit Polyclonal Antibody (Cy3)
orb980028 100 µL

ENO4 Rabbit Polyclonal Antibody (Cy3)

Sign In for Pricing
View Details
Porcine CD13 protein
orb603901-01 20 µg

Porcine CD13 protein

Sign In for Pricing
View Details