Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NR4A1 Peptide - C-terminal region

NR4A1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

GFRP1, HMR, MGC9485, N10, NAK-1, NGFIB, NP10, NUR77, TR3

UniProt

P22736

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NR4A1 Rabbit Polyclonal Antibody (orb574299) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_002126

Preservative

Lyophilized powder

AA Sequence

RGRLPSKPKQPPDASPANLLTSLVRAHLDSGPSTAKLDYSKFQELVLPHF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pyruvic Acid Colorimetric Assay Kit
E-BC-K130-S-01 50 Assays (48 samples)

Pyruvic Acid Colorimetric Assay Kit

Sign In for Pricing
View Details
Pyruvic Acid Colorimetric Assay Kit
E-BC-K130-S-02 100 Assays (96 samples)

Pyruvic Acid Colorimetric Assay Kit

Sign In for Pricing
View Details
Tissue FFPE Sections, Renal pelvis
CS705032 5x 5 µm

Tissue FFPE Sections, Renal pelvis

Sign In for Pricing
View Details
Tissue FFPE Sections, Colon: left
CS709309 5x 5 µm

Tissue FFPE Sections, Colon: left

Sign In for Pricing
View Details
RH 1788
TRC-R315765-250MG 250 mg

RH 1788

Sign In for Pricing
View Details
Elastopar
TRC-E324550-10MG 10 mg

Elastopar

Sign In for Pricing
View Details