NR4A1 Peptide - C-terminal region
NR4A1 Peptide - C-terminal region
Product Specifications
Product Name Alternative
GFRP1, HMR, MGC9485, N10, NAK-1, NGFIB, NP10, NUR77, TR3
UniProt
P22736
Field of Research
Immunology & Inflammation
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with NR4A1 Rabbit Polyclonal Antibody (orb574299) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_002126
Preservative
Lyophilized powder
AA Sequence
RGRLPSKPKQPPDASPANLLTSLVRAHLDSGPSTAKLDYSKFQELVLPHF
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
15296-AAT 100 Tests
Cell Meter™ Intracellular NADH/NADPH Flow Cytometric Analysis Kit *Deep Red Fluorescence*
Sign In for Pricing
View Details 
22903-AAT 200 Tests
Cell Meter™ Fluorimetric Intracellular Total ROS Activity Assay Kit*Deep Red Fluorescence*
Sign In for Pricing
View Details 
