Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NT5C1A Peptide - C-terminal region

NT5C1A Peptide - C-terminal region

Product Specifications

Product Name Alternative

CN-I, CN-IA, CN1, CN1A, MGC119199, MGC119201

UniProt

Q9BXI3

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NT5C1A Rabbit Polyclonal Antibody (orb584652) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_115915

Preservative

Lyophilized powder

AA Sequence

AHGLDRFFEHEKAHENKPLAQGPLKGFLEALGRLQKKFYSKGLRLECPIR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human SerpinH1 Protein
KMPH6481 100 µg

Human SerpinH1 Protein

Sign In for Pricing
View Details
Topo IIIβ-1 Rabbit Polyclonal Antibody
E28PT4698 100 µL

Topo IIIβ-1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Phospho-CHEK2 (Thr383) Rabbit Polyclonal Antibody (Cy3)
orb985196 100 µL

Phospho-CHEK2 (Thr383) Rabbit Polyclonal Antibody (Cy3)

Sign In for Pricing
View Details
MYCT1 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)
31219154 3x 1.0 µg DNA

MYCT1 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)

Sign In for Pricing
View Details
Recombinant Clostridium Kluyveri xseB Protein (aa 1-72) (strain NBRC 12016)
VAng-Lsx9884-500gEcoli 500 µg (E. coli)

Recombinant Clostridium Kluyveri xseB Protein (aa 1-72) (strain NBRC 12016)

Sign In for Pricing
View Details
Tyrosinase (TYR, LB24 AB, LB24-AB, Monophenol Monooxygenase, Oculocutaneous Albinism IA, OCA1A, OCAIA, SK29 AB, SK29-AB, Tumor Rejection Antigen AB)
T9228-75F 200 µg

Tyrosinase (TYR, LB24 AB, LB24-AB, Monophenol Monooxygenase, Oculocutaneous Albinism IA, OCA1A, OCAIA, SK29 AB, SK29-AB, Tumor Rejection Antigen AB)

Sign In for Pricing
View Details