Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NXT1 Peptide - N-terminal region

NXT1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

MTR2, P15

UniProt

Q9UKK6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NXT1 Rabbit Polyclonal Antibody (orb582547) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_037380

Preservative

Lyophilized powder

AA Sequence

GTATLVWNGNAVSGQESLSEFFEMLPSSEFQISVVDCQPVHDEATPSQTT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Complement C4 AssayLite™ Antibody (FITC Conjugate)
11231-05041 2x 75 µg

Human Complement C4 AssayLite™ Antibody (FITC Conjugate)

Sign In for Pricing
View Details
OSGEPL1 Lentiviral Activation Particles (h2)
sc-418445-LAC-2 200 µL

OSGEPL1 Lentiviral Activation Particles (h2)

Sign In for Pricing
View Details
EPHX2 Goat Polyclonal Antibody
AP33492PU-N 100 µg

EPHX2 Goat Polyclonal Antibody

Sign In for Pricing
View Details
LNX1 Protein Vector (Rat) (pPM-C-HA)
26925026 500 ng

LNX1 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
Bovine soluble cluster of differentiation 8 (sCD8) Elisa Kit
EK760027 96 Well

Bovine soluble cluster of differentiation 8 (sCD8) Elisa Kit

Sign In for Pricing
View Details
LDHAL6B Antibody (N-term)
E45R10890G-1 100 µL

LDHAL6B Antibody (N-term)

Sign In for Pricing
View Details