Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NXT1 Peptide - N-terminal region

NXT1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

MTR2, P15

UniProt

Q9UKK6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NXT1 Rabbit Polyclonal Antibody (orb582547) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_037380

Preservative

Lyophilized powder

AA Sequence

GTATLVWNGNAVSGQESLSEFFEMLPSSEFQISVVDCQPVHDEATPSQTT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BJ-TSA-9 Lentiviral Activation Particles (h2)
sc-413753-LAC-2 200 µL

BJ-TSA-9 Lentiviral Activation Particles (h2)

Sign In for Pricing
View Details
CDK2 Recombinant Protein (Human)
RP006610 100 µg

CDK2 Recombinant Protein (Human)

Sign In for Pricing
View Details
LHX2 Mouse mAb
E2220555 100 µL

LHX2 Mouse mAb

Sign In for Pricing
View Details
4-Nitrophenyl 2,3-Di-O- (2,3,4,6-tetra-O-acetyl-β-D-glucopyranosyl) -β-D-glucopyranoside
sc-284400 1 mg

4-Nitrophenyl 2,3-Di-O- (2,3,4,6-tetra-O-acetyl-β-D-glucopyranosyl) -β-D-glucopyranoside

Sign In for Pricing
View Details
Recombinant Human IL-12
HEILP-1201 10 µg

Recombinant Human IL-12

Sign In for Pricing
View Details
Hexane 65-70° C 85% Extrapure
134700500 500 mL

Hexane 65-70° C 85% Extrapure

Sign In for Pricing
View Details