Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Onecut3 Peptide - C-terminal region

Onecut3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

OC-3, Oc3

UniProt

Q8K557

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Onecut3 Rabbit Polyclonal Antibody (orb576322) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_631972

Preservative

Lyophilized powder

AA Sequence

QATISQQLGLELNTVSNFFMNARRRCMNRWAEEPGATPGTGTATATFSKA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FrwB Antibody
orb824644 2 mg

FrwB Antibody

Sign In for Pricing
View Details
FDC-SP Rabbit Polyclonal Antibody (BF350)
orb2487716 100 µL

FDC-SP Rabbit Polyclonal Antibody (BF350)

Sign In for Pricing
View Details
Olr312 (NM_001000764) Rat Tagged ORF Clone
RR211001 10 µg

Olr312 (NM_001000764) Rat Tagged ORF Clone

Sign In for Pricing
View Details
Yellow head virus
Oneq-V294-01 Oneq-V294-50R

Yellow head virus

Sign In for Pricing
View Details
Yellow head virus
Oneq-V294-02 Oneq-V294-100R

Yellow head virus

Sign In for Pricing
View Details
Yellow head virus
Oneq-V294-03 Oneq-V294-150R

Yellow head virus

Sign In for Pricing
View Details