Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Onecut3 Peptide - C-terminal region

Onecut3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

OC-3, Oc3

UniProt

Q8K557

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Onecut3 Rabbit Polyclonal Antibody (orb576322) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_631972

Preservative

Lyophilized powder

AA Sequence

QATISQQLGLELNTVSNFFMNARRRCMNRWAEEPGATPGTGTATATFSKA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Acidovorax sp. PKHD-type hydroxylase Ajs_0512 (Ajs_0512)
MBS1183060-01 0.02 mg (E-Coli)

Recombinant Acidovorax sp. PKHD-type hydroxylase Ajs_0512 (Ajs_0512)

Sign In for Pricing
View Details
Recombinant Acidovorax sp. PKHD-type hydroxylase Ajs_0512 (Ajs_0512)
MBS1183060-02 0.1 mg (E-Coli)

Recombinant Acidovorax sp. PKHD-type hydroxylase Ajs_0512 (Ajs_0512)

Sign In for Pricing
View Details
Recombinant Acidovorax sp. PKHD-type hydroxylase Ajs_0512 (Ajs_0512)
MBS1183060-03 0.02 mg (Yeast)

Recombinant Acidovorax sp. PKHD-type hydroxylase Ajs_0512 (Ajs_0512)

Sign In for Pricing
View Details
Recombinant Acidovorax sp. PKHD-type hydroxylase Ajs_0512 (Ajs_0512)
MBS1183060-04 0.1 mg (Yeast)

Recombinant Acidovorax sp. PKHD-type hydroxylase Ajs_0512 (Ajs_0512)

Sign In for Pricing
View Details
Recombinant Acidovorax sp. PKHD-type hydroxylase Ajs_0512 (Ajs_0512)
MBS1183060-05 0.02 mg (Baculovirus)

Recombinant Acidovorax sp. PKHD-type hydroxylase Ajs_0512 (Ajs_0512)

Sign In for Pricing
View Details
Recombinant Acidovorax sp. PKHD-type hydroxylase Ajs_0512 (Ajs_0512)
MBS1183060-06 0.02 mg (Mammalian-Cell)

Recombinant Acidovorax sp. PKHD-type hydroxylase Ajs_0512 (Ajs_0512)

Sign In for Pricing
View Details