Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR1L8 Peptide - C-terminal region

OR1L8 Peptide - C-terminal region

Product Specifications

Product Name Alternative

OR9-24

UniProt

Q8NGR8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OR1L8 Rabbit Polyclonal Antibody (orb326306) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001004454

Preservative

Lyophilized powder

AA Sequence

MTEAPIVLVTRFLCIAFSYIRILTTVLKIPSTSGKRKAFSTCGFYLTVVT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

1-Ethyl-1H-1,2,3-triazole-4-carboxylic acid
LYB54199-01 50 mg

1-Ethyl-1H-1,2,3-triazole-4-carboxylic acid

Sign In for Pricing
View Details
1-Ethyl-1H-1,2,3-triazole-4-carboxylic acid
LYB54199-02 0.5 g

1-Ethyl-1H-1,2,3-triazole-4-carboxylic acid

Sign In for Pricing
View Details
Anti-PSIP1 Antibody Picoband® Fluoro550 Conjugated
A01960-2-Fluoro550 100 µg/Vial

Anti-PSIP1 Antibody Picoband® Fluoro550 Conjugated

Sign In for Pricing
View Details
KMT5C (NM_032701) Human Over-expression Lysate
LS084787 100 µg

KMT5C (NM_032701) Human Over-expression Lysate

Sign In for Pricing
View Details
SEPT2 Antibody
E035014 100 µg -100 µL

SEPT2 Antibody

Sign In for Pricing
View Details
AdmiRa-rno-let-7a-1-3p Virus
mr0449 250 µL

AdmiRa-rno-let-7a-1-3p Virus

Sign In for Pricing
View Details