Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR1L8 Peptide - C-terminal region

OR1L8 Peptide - C-terminal region

Product Specifications

Product Name Alternative

OR9-24

UniProt

Q8NGR8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OR1L8 Rabbit Polyclonal Antibody (orb326306) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001004454

Preservative

Lyophilized powder

AA Sequence

MTEAPIVLVTRFLCIAFSYIRILTTVLKIPSTSGKRKAFSTCGFYLTVVT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HIST1H3A (Ab-14) Antibody
A25091-50UL 50 μL

HIST1H3A (Ab-14) Antibody

Sign In for Pricing
View Details
GABA A Receptor gamma 2 Rabbit Polyclonal Antibody (APC-Cy7)
orb1815563 100 µL

GABA A Receptor gamma 2 Rabbit Polyclonal Antibody (APC-Cy7)

Sign In for Pricing
View Details
SAP130 (NM_001145928) Human Tagged ORF Clone Lentiviral Particle
RC229061L3V 200 µL

SAP130 (NM_001145928) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
CENPA, ID (CENPA, Histone H3-like centromeric protein A, Centromere autoantigen A, Centromere protein A) (MaxLight 750) discontinued
033762-ML750 100 µL

CENPA, ID (CENPA, Histone H3-like centromeric protein A, Centromere autoantigen A, Centromere protein A) (MaxLight 750) discontinued

Sign In for Pricing
View Details
RPS3AP24 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV782046 1.0 µg DNA

RPS3AP24 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details
SNX18P5 Protein Vector (Human) (pPB-N-His)
PV132547 500 ng

SNX18P5 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details