Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR2H2 Peptide - C-terminal region

OR2H2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

FAT11, MGC126732, MGC138381, OLFR2, OLFR42B, OR2H3, dJ271M21.2, hs6M1-12

UniProt

O95918

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OR2H2 Rabbit Polyclonal Antibody (orb584428) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_009091

Preservative

Lyophilized powder

AA Sequence

FPSSTHPEDTDKIGAVLFTVVTPMINPFIYSLRNKDMKGALRKLINRKIS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BRUNOL6 (CELF6) CytoSection
TS405606P5 25 Slides

BRUNOL6 (CELF6) CytoSection

Sign In for Pricing
View Details
OTOP2 Adenovirus (Human)
35800051 1.0 mL

OTOP2 Adenovirus (Human)

Sign In for Pricing
View Details
Phospho-RPS6KB1 (Ser417) Polyclonal Antibody, APC Conjugated
bs-5668R-APC 100 µL

Phospho-RPS6KB1 (Ser417) Polyclonal Antibody, APC Conjugated

Sign In for Pricing
View Details
1-Butyl-3-methylimidazolium hexafluorophosphate
IL-0011-UP-0500 500 g

1-Butyl-3-methylimidazolium hexafluorophosphate

Sign In for Pricing
View Details
Olr1469 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV662086 1.0 µg DNA

Olr1469 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details
1- (4- (cyclohexyloxy) phenyl) propan-1-ol
OR1080649-01 250 mg

1- (4- (cyclohexyloxy) phenyl) propan-1-ol

Sign In for Pricing
View Details