Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR2H2 Peptide - C-terminal region

OR2H2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

FAT11, MGC126732, MGC138381, OLFR2, OLFR42B, OR2H3, dJ271M21.2, hs6M1-12

UniProt

O95918

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OR2H2 Rabbit Polyclonal Antibody (orb584428) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_009091

Preservative

Lyophilized powder

AA Sequence

FPSSTHPEDTDKIGAVLFTVVTPMINPFIYSLRNKDMKGALRKLINRKIS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Escherichia coli O45:K1 Citrate lyase acyl carrier protein (citD)
MBS1212030-01 0.02 mg (E-Coli)

Recombinant Escherichia coli O45:K1 Citrate lyase acyl carrier protein (citD)

Sign In for Pricing
View Details
Recombinant Escherichia coli O45:K1 Citrate lyase acyl carrier protein (citD)
MBS1212030-02 0.1 mg (E-Coli)

Recombinant Escherichia coli O45:K1 Citrate lyase acyl carrier protein (citD)

Sign In for Pricing
View Details
Recombinant Escherichia coli O45:K1 Citrate lyase acyl carrier protein (citD)
MBS1212030-03 0.02 mg (Yeast)

Recombinant Escherichia coli O45:K1 Citrate lyase acyl carrier protein (citD)

Sign In for Pricing
View Details
Recombinant Escherichia coli O45:K1 Citrate lyase acyl carrier protein (citD)
MBS1212030-04 0.1 mg (Yeast)

Recombinant Escherichia coli O45:K1 Citrate lyase acyl carrier protein (citD)

Sign In for Pricing
View Details
Recombinant Escherichia coli O45:K1 Citrate lyase acyl carrier protein (citD)
MBS1212030-05 0.02 mg (Baculovirus)

Recombinant Escherichia coli O45:K1 Citrate lyase acyl carrier protein (citD)

Sign In for Pricing
View Details
Recombinant Escherichia coli O45:K1 Citrate lyase acyl carrier protein (citD)
MBS1212030-06 1 mg (E-Coli)

Recombinant Escherichia coli O45:K1 Citrate lyase acyl carrier protein (citD)

Sign In for Pricing
View Details