Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR2W1 Peptide - C-terminal region

OR2W1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MGC119162, MGC119163, MGC119165, hs6M1-15

UniProt

Q9Y3N9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OR2W1 Rabbit Polyclonal Antibody (orb584459) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_112165

Preservative

Lyophilized powder

AA Sequence

VVSMFYGTIIYMYLQPGNRASKDQGKFLTLFYTVITPSLNPLIYTLRNKD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PTH / Parathyroid Hormone (N-Terminal) (PTH/1173), CF647 conjugate, 0.1mg/mL
BNC471173-500 1x 500 µL

PTH / Parathyroid Hormone (N-Terminal) (PTH/1173), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human SEMA4G activation kit by CRISPRa
GA111707 1 Kit

Human SEMA4G activation kit by CRISPRa

Sign In for Pricing
View Details
OR11H6 Human Gene Knockout Kit (CRISPR)
KN414860 1 Kit

OR11H6 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
PE Anti-Mouse Ly6A/E (Sca-1) Antibody[D7]
E-AB-F1191D-01 50 Tests

PE Anti-Mouse Ly6A/E (Sca-1) Antibody[D7]

Sign In for Pricing
View Details
PE Anti-Mouse Ly6A/E (Sca-1) Antibody[D7]
E-AB-F1191D-02 100 Tests

PE Anti-Mouse Ly6A/E (Sca-1) Antibody[D7]

Sign In for Pricing
View Details
PE Anti-Mouse Ly6A/E (Sca-1) Antibody[D7]
E-AB-F1191D-03 2x 100 Tests

PE Anti-Mouse Ly6A/E (Sca-1) Antibody[D7]

Sign In for Pricing
View Details