Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR2W1 Peptide - C-terminal region

OR2W1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MGC119162, MGC119163, MGC119165, hs6M1-15

UniProt

Q9Y3N9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OR2W1 Rabbit Polyclonal Antibody (orb584459) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_112165

Preservative

Lyophilized powder

AA Sequence

VVSMFYGTIIYMYLQPGNRASKDQGKFLTLFYTVITPSLNPLIYTLRNKD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cardiac Troponin T (TNNT2) Mouse Monoclonal Antibody [Clone ID: OTI3C3]
CF807956 100 µg

Cardiac Troponin T (TNNT2) Mouse Monoclonal Antibody [Clone ID: OTI3C3]

Sign In for Pricing
View Details
NVL Human Gene Knockout Kit (CRISPR)
KN415387 1 Kit

NVL Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
beta,2-Dihydroxybenzenepropanoic Acid
TRC-D679018-100MG 100 mg

beta,2-Dihydroxybenzenepropanoic Acid

Sign In for Pricing
View Details
Histone H3 (acetyl K14) Recombinant Rabbit monoclonal Antibody [JU43-26]
ET1706-28-50UL 50 µL

Histone H3 (acetyl K14) Recombinant Rabbit monoclonal Antibody [JU43-26]

Sign In for Pricing
View Details
1,5-Anhydro-l-glucitol Bromhexine
TRC-B678657-50MG 50 mg

1,5-Anhydro-l-glucitol Bromhexine

Sign In for Pricing
View Details
MRE-269
TRC-M750110-5MG 5 mg

MRE-269

Sign In for Pricing
View Details