Oxsr1 Peptide - middle region
Oxsr1 Peptide - middle region
Product Specifications
Product Name Alternative
2210022N24Rik, 2810422B09Rik, AI462649, AW209236, Osr1, mKIAA1101
UniProt
Q6P9R2
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Oxsr1 Rabbit Polyclonal Antibody (orb330562) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_598746
Preservative
Lyophilized powder
AA Sequence
RAPTISERSKKVRRVPGSSGRLHKTEDGGWEWSDDEFDEESEEGRAAISQ
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
A09782-2-Fluoro594 100 µg/Vial
Anti-SLC25A27 Antibody Picoband® Fluoro594 Conjugated
Sign In for Pricing
View Details 
246376-ML405 100 µL
FTL (Ferritin, Light Polypeptide, MGC71996) (MaxLight 405) discontinued
Sign In for Pricing
View Details MBS8111419-01 0.1 mL
Recombinant Anti-Cathepsin A Antibody, Rabbit Monoclonal
Sign In for Pricing
View Details MBS8111419-02 5x 0.1 mL
Recombinant Anti-Cathepsin A Antibody, Rabbit Monoclonal
Sign In for Pricing
View Details