Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Oxsr1 Peptide - middle region

Oxsr1 Peptide - middle region

Product Specifications

Product Name Alternative

2210022N24Rik, 2810422B09Rik, AI462649, AW209236, Osr1, mKIAA1101

UniProt

Q6P9R2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Oxsr1 Rabbit Polyclonal Antibody (orb330562) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_598746

Preservative

Lyophilized powder

AA Sequence

RAPTISERSKKVRRVPGSSGRLHKTEDGGWEWSDDEFDEESEEGRAAISQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RAD51 (Prognostic and Response to Chemotherapy Marker) (RAD51/2702), CF568 conjugate, 0.1mg/mL
BNC682702-500 1x 500 µL

RAD51 (Prognostic and Response to Chemotherapy Marker) (RAD51/2702), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Triricinolein
TRC-T902050-10MG 10 mg

Triricinolein

Sign In for Pricing
View Details
BLVRB Polyclonal Antibody
E-AB-19616-01 20 µL

BLVRB Polyclonal Antibody

Sign In for Pricing
View Details
BLVRB Polyclonal Antibody
E-AB-19616-02 60 µL

BLVRB Polyclonal Antibody

Sign In for Pricing
View Details
BLVRB Polyclonal Antibody
E-AB-19616-03 120 µL

BLVRB Polyclonal Antibody

Sign In for Pricing
View Details
BLVRB Polyclonal Antibody
E-AB-19616-04 200 µL

BLVRB Polyclonal Antibody

Sign In for Pricing
View Details