Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PACS2 Peptide - middle region

PACS2 Peptide - middle region

Product Specifications

Product Name Alternative

FLJ25488, KIAA0602, PACS1L, PACS-2

UniProt

Q86VP3

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PACS2 Rabbit Polyclonal Antibody (orb581390) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_056012

Preservative

Lyophilized powder

AA Sequence

AHQLPIAEAMLTYKQKSPDEESSQKFIPFVGVVKVGIVEPSSATSGDSDD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DDX3/DEAD-box Protein 3 (Ab-322) Antibody
8B0902-AAT 50 µg

DDX3/DEAD-box Protein 3 (Ab-322) Antibody

Sign In for Pricing
View Details
Frozen Tissue Sections, Ovary: right
CS507411 5x 5 µm

Frozen Tissue Sections, Ovary: right

Sign In for Pricing
View Details
CDX2 Antibody
OC-146-01 50 μL

CDX2 Antibody

Sign In for Pricing
View Details
CDX2 Antibody
OC-146-02 100 µL

CDX2 Antibody

Sign In for Pricing
View Details
CDX2 Antibody
OC-146-03 1 mL

CDX2 Antibody

Sign In for Pricing
View Details
Microphthalmia Transcription Factor (MITF) (MITF/2987R), CF740 conjugate, 0.1mg/mL
BNC742987-500 1x 500 µL

Microphthalmia Transcription Factor (MITF) (MITF/2987R), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details