Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PACS2 Peptide - middle region

PACS2 Peptide - middle region

Product Specifications

Product Name Alternative

FLJ25488, KIAA0602, PACS1L, PACS-2

UniProt

Q86VP3

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PACS2 Rabbit Polyclonal Antibody (orb581390) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_056012

Preservative

Lyophilized powder

AA Sequence

AHQLPIAEAMLTYKQKSPDEESSQKFIPFVGVVKVGIVEPSSATSGDSDD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Obi1 Mouse Gene Knockout Kit (CRISPR)
KN514942 1 Kit

Obi1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
p-Coumaric acid
TRC-C755365-50G 50 g

p-Coumaric acid

Sign In for Pricing
View Details
BNP (NPPB) Human Gene Knockout Kit (CRISPR)
KN206590BN 1 Kit

BNP (NPPB) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
p-Nitrophenyl Beta-D-Glucuronide Sodium Salt
TRC-N503700-250MG 250 mg

p-Nitrophenyl Beta-D-Glucuronide Sodium Salt

Sign In for Pricing
View Details
COPS3 Rabbit Polyclonal Antibody
TA366268 100 µL

COPS3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Copper(II) Sulfate Pentahydrate
TRC-C685370-5G 5 g

Copper(II) Sulfate Pentahydrate

Sign In for Pricing
View Details