Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRKN Peptide - C-terminal region

PRKN Peptide - C-terminal region

Product Specifications

Product Name Alternative

Park2

UniProt

Q9WVS6

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PRKN Rabbit Polyclonal Antibody (orb578692) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_057903

Preservative

Lyophilized powder

AA Sequence

YTRYQQYGAEECVLQMGGVLCPRPGCGAGLLPEQGQRKVTCEGGNGLGCG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRIM64B CRISPR Activation Plasmid (h)
sc-417314-ACT 20 µg

TRIM64B CRISPR Activation Plasmid (h)

Sign In for Pricing
View Details
80nm Colloidal Gold, Ultra-high Concentration
G5876 10 mL

80nm Colloidal Gold, Ultra-high Concentration

Sign In for Pricing
View Details
CD85c Polyclonal Antibody
ABP53241-01 30 µL

CD85c Polyclonal Antibody

Sign In for Pricing
View Details
CD85c Polyclonal Antibody
ABP53241-02 100 µL

CD85c Polyclonal Antibody

Sign In for Pricing
View Details
CD85c Polyclonal Antibody
ABP53241-03 200 µL

CD85c Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit ALB/Albumin Recombinant Protein (N-His)
TY411012-01 50 µg

Rabbit ALB/Albumin Recombinant Protein (N-His)

Sign In for Pricing
View Details