Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRKN Peptide - C-terminal region

PRKN Peptide - C-terminal region

Product Specifications

Product Name Alternative

Park2

UniProt

Q9WVS6

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PRKN Rabbit Polyclonal Antibody (orb578692) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_057903

Preservative

Lyophilized powder

AA Sequence

YTRYQQYGAEECVLQMGGVLCPRPGCGAGLLPEQGQRKVTCEGGNGLGCG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Protein angel homolog 2 (ANGEL2) Human ELISA Kit
G2375 96 Tests

Protein angel homolog 2 (ANGEL2) Human ELISA Kit

Sign In for Pricing
View Details
C6 NBD-Sphingosylphosphorylcholine
MBS393324-01 0.1 mg

C6 NBD-Sphingosylphosphorylcholine

Sign In for Pricing
View Details
C6 NBD-Sphingosylphosphorylcholine
MBS393324-02 1 mg

C6 NBD-Sphingosylphosphorylcholine

Sign In for Pricing
View Details
C6 NBD-Sphingosylphosphorylcholine
MBS393324-03 5x 1 mg

C6 NBD-Sphingosylphosphorylcholine

Sign In for Pricing
View Details
DDX3X Antibody
GWB-MM363C 50 µg

DDX3X Antibody

Sign In for Pricing
View Details
Recombinant Mouse TNF Receptor Associated Factor 1 (TRAF1)
RPU44055-01 50 µg

Recombinant Mouse TNF Receptor Associated Factor 1 (TRAF1)

Sign In for Pricing
View Details