Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PCP2 Peptide - N-terminal region

PCP2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

DKFZp686M0187, FLJ27345, GPSM4, L7, MGC41903

UniProt

Q8IVA1

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PCP2 Rabbit Polyclonal Antibody (orb582022) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_777555

Preservative

Lyophilized powder

AA Sequence

MMDQEEKTEEGSGPCAEAGSPDQEGFFNLLSHVQGDRMEGQRCSLQAGPG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tricyclene
TRC-T797465-50MG 50 mg

Tricyclene

Sign In for Pricing
View Details
Rat Fibroblast Growth Factor 6 (FGF6) ELISA Kit
RDR-FGF6-Ra-01 96 Tests

Rat Fibroblast Growth Factor 6 (FGF6) ELISA Kit

Sign In for Pricing
View Details
Rat Fibroblast Growth Factor 6 (FGF6) ELISA Kit
RDR-FGF6-Ra-02 48 Tests

Rat Fibroblast Growth Factor 6 (FGF6) ELISA Kit

Sign In for Pricing
View Details
LB*Booster™, Powder 500
0126 500 mL

LB*Booster™, Powder 500

Sign In for Pricing
View Details
Human SPEM3 activation kit by CRISPRa
GA119792 1 Kit

Human SPEM3 activation kit by CRISPRa

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS706480 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details