Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PCP2 Peptide - N-terminal region

PCP2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

DKFZp686M0187, FLJ27345, GPSM4, L7, MGC41903

UniProt

Q8IVA1

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PCP2 Rabbit Polyclonal Antibody (orb582022) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_777555

Preservative

Lyophilized powder

AA Sequence

MMDQEEKTEEGSGPCAEAGSPDQEGFFNLLSHVQGDRMEGQRCSLQAGPG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD4 (C4/206), CF488A conjugate, 0.1mg/mL
BNC880206-500 1x 500 µL

CD4 (C4/206), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
KLK9 Antibody (Biotin)
KB-40034-01 50 μL

KLK9 Antibody (Biotin)

Sign In for Pricing
View Details
KLK9 Antibody (Biotin)
KB-40034-02 100 µL

KLK9 Antibody (Biotin)

Sign In for Pricing
View Details
KLK9 Antibody (Biotin)
KB-40034-03 1 mL

KLK9 Antibody (Biotin)

Sign In for Pricing
View Details
GADD34 (PPP1R15A) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1E1]
TA504359BM 100 µL

GADD34 (PPP1R15A) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1E1]

Sign In for Pricing
View Details
MTURN Human qPCR Primer Pair (NM_152793)
HP217975 200 Reactions

MTURN Human qPCR Primer Pair (NM_152793)

Sign In for Pricing
View Details