PDE8A Peptide - C-terminal region
PDE8A Peptide - C-terminal region
Product Specifications
Product Name Alternative
FLJ16150, HsT19550
UniProt
O60658
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with PDE8A Rabbit Polyclonal Antibody (orb583696) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_775656
Preservative
Lyophilized powder
AA Sequence
VSNPCRPLQYCIEWAARISEEYFSQTDEEKQQGLPVVMPVFDRNTCSIPK
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS6364537-01 0.2 mL
ZBTB11, CT (ZBTB11, Zinc finger and BTB domain-containing protein 11) (FITC)
Sign In for Pricing
View Details 
MBS6364537-02 5x 0.2 mL
ZBTB11, CT (ZBTB11, Zinc finger and BTB domain-containing protein 11) (FITC)
Sign In for Pricing
View Details 
MBS6323912-01 0.2 mL
NAT13, CT (NAA50, MAK3, NAT13, NAT5, N-alpha-acetyltransferase 50, N-acetyltransferase 13, N-acetyltransferase 5, N-acetyltransferase san homolog, NatE catalytic subunit) (PE)
Sign In for Pricing
View Details MBS6323912-02 5x 0.2 mL
NAT13, CT (NAA50, MAK3, NAT13, NAT5, N-alpha-acetyltransferase 50, N-acetyltransferase 13, N-acetyltransferase 5, N-acetyltransferase san homolog, NatE catalytic subunit) (PE)
Sign In for Pricing
View Details RC207463L1V 200 µL
DEXI (NM_014015) Human Tagged ORF Clone Lentiviral Particle
Sign In for Pricing
View Details