Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PDE8A Peptide - C-terminal region

PDE8A Peptide - C-terminal region

Product Specifications

Product Name Alternative

FLJ16150, HsT19550

UniProt

O60658

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PDE8A Rabbit Polyclonal Antibody (orb583696) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_775656

Preservative

Lyophilized powder

AA Sequence

VSNPCRPLQYCIEWAARISEEYFSQTDEEKQQGLPVVMPVFDRNTCSIPK

More Discoveries

Explore Other Products

Browse additional items from our catalog

Guinea pig ADP-ribosylation factor 3 (ARF3) ELISA Kit
MBS7243822-01 48 Well

Guinea pig ADP-ribosylation factor 3 (ARF3) ELISA Kit

Sign In for Pricing
View Details
Guinea pig ADP-ribosylation factor 3 (ARF3) ELISA Kit
MBS7243822-02 96 Well

Guinea pig ADP-ribosylation factor 3 (ARF3) ELISA Kit

Sign In for Pricing
View Details
Guinea pig ADP-ribosylation factor 3 (ARF3) ELISA Kit
MBS7243822-03 5x 96 Well

Guinea pig ADP-ribosylation factor 3 (ARF3) ELISA Kit

Sign In for Pricing
View Details
Guinea pig ADP-ribosylation factor 3 (ARF3) ELISA Kit
MBS7243822-04 10x 96 Well

Guinea pig ADP-ribosylation factor 3 (ARF3) ELISA Kit

Sign In for Pricing
View Details
Anti-Anopheles gambiae (African malaria mosquito) AgCactus Antibody Fluoro647 Conjugated
DZ41846-Fluoro647 200 µL/Vial

Anti-Anopheles gambiae (African malaria mosquito) AgCactus Antibody Fluoro647 Conjugated

Sign In for Pricing
View Details
Human OR2D3 Knockout HEK293T cell line
GTR15404620 1 Vial

Human OR2D3 Knockout HEK293T cell line

Sign In for Pricing
View Details