Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Pfkfb2 Peptide - C-terminal region

Pfkfb2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

4930568D07Rik

UniProt

Q6GTL7

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Pfkfb2 Rabbit Polyclonal Antibody (orb330879) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_032851

Preservative

Lyophilized powder

AA Sequence

RNSFTPLSSSNTIRRPRNYSVGSRPLKPLSPLRALDMQEGADQPKTQVSI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CARM1/PRMT4 Antibody
MBS9415974-01 0.1 mL

CARM1/PRMT4 Antibody

Sign In for Pricing
View Details
CARM1/PRMT4 Antibody
MBS9415974-02 5x 0.1 mL

CARM1/PRMT4 Antibody

Sign In for Pricing
View Details
YbhQ Antibody
orb829194 2 mg

YbhQ Antibody

Sign In for Pricing
View Details
Thyme Oil Extrapure
2693A 00500 500 mL

Thyme Oil Extrapure

Sign In for Pricing
View Details
CD126/IL6R/IL-6RA Protein (N-His, Mus musculus (Mouse) )
P501476 100 µg

CD126/IL6R/IL-6RA Protein (N-His, Mus musculus (Mouse) )

Sign In for Pricing
View Details
Recombinant Cynomolgus CTLA-4 Protein
orb2994852-01 10 µg

Recombinant Cynomolgus CTLA-4 Protein

Sign In for Pricing
View Details