Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PHF5A Peptide - middle region

PHF5A Peptide - middle region

Product Specifications

Product Name Alternative

INI, MGC1346, SF3b14b, bK223H9.2, Rds3, SAP14b

UniProt

Q7RTV0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PHF5A Rabbit Polyclonal Antibody (orb580179) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_116147

Preservative

Lyophilized powder

AA Sequence

ICGGPGVSDAYYCKECTIQEKDRDGCPKIVNLGSSKTDLFYERKKYGFKK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Trypsin (MS grade)
HY-129047A 100 µg

Trypsin (MS grade)

Sign In for Pricing
View Details
Rabbit Polyclonal UBXN2A Antibody [Alexa Fluor 700]
NBP2-98564AF700 0.1 mL

Rabbit Polyclonal UBXN2A Antibody [Alexa Fluor 700]

Sign In for Pricing
View Details
Recombinant Schizosaccharomyces Pombe SPCC777.03c Protein (aa 1-396)
VAng-Yyj6237-1mgEcoli 1 mg (E. coli)

Recombinant Schizosaccharomyces Pombe SPCC777.03c Protein (aa 1-396)

Sign In for Pricing
View Details
Mouse Tolloid-like protein 1 (TLL1) ELISA Kit
KTE70215-01 48 Tests

Mouse Tolloid-like protein 1 (TLL1) ELISA Kit

Sign In for Pricing
View Details
Mouse Tolloid-like protein 1 (TLL1) ELISA Kit
KTE70215-02 96 Tests

Mouse Tolloid-like protein 1 (TLL1) ELISA Kit

Sign In for Pricing
View Details
Mouse Tolloid-like protein 1 (TLL1) ELISA Kit
KTE70215-03 5x 96 Tests

Mouse Tolloid-like protein 1 (TLL1) ELISA Kit

Sign In for Pricing
View Details