Pias2 Peptide - N-terminal region
Pias2 Peptide - N-terminal region
Product Specifications
Product Name Alternative
6330408K17Rik, AI462206, ARIP3, AU018068, Dib, Miz1, PIASxalpha, PIASxb, PIASxbeta, SIZ2
UniProt
Q8C5D8
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Pias2 Rabbit Polyclonal Antibody (orb330731) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001157639
Preservative
Lyophilized powder
AA Sequence
PAVQIKIRELYRRRYPRTLEGLCDLSTIKSSVFSLDGSSSPVEPDLPVAG
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![PD1 (PDCD1) Mouse Monoclonal Antibody [Clone ID: OTI12G4]](https://cdn.genprice.uk/products/937/68dd18b9061270361e9081d7/imageurl/cf807868.webp)
CF807868 100 µg
PD1 (PDCD1) Mouse Monoclonal Antibody [Clone ID: OTI12G4]
Sign In for Pricing
View Details ![RBX1 Recombinant Rabbit Monoclonal Antibody [PSH07-01]](https://cdn.genprice.uk/products/992/68dd1c8b061270361ea8173a/imageurl/ha722779.webp)
HA722779 100 µL
RBX1 Recombinant Rabbit Monoclonal Antibody [PSH07-01]
Sign In for Pricing
View Details 